SLC41A2 polyclonal antibody
  • SLC41A2 polyclonal antibody

SLC41A2 polyclonal antibody

Ref: AB-PAB23324
SLC41A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC41A2.
Información adicional
Size 100 uL
Gene Name SLC41A2
Gene Alias DKFZp434K0427|MGC125330|MGC125331|SLC41A1-L1
Gene Description solute carrier family 41, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLSTAVQTFSNRSEQHMEYHSFSEQSFHANNGHASSSCSQKYDDYANYNYCDGRETSETTAMLQDEDISSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC41A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84102
Iso type IgG

Enviar un mensaje


SLC41A2 polyclonal antibody

SLC41A2 polyclonal antibody