TBC1D12 polyclonal antibody
  • TBC1D12 polyclonal antibody

TBC1D12 polyclonal antibody

Ref: AB-PAB23322
TBC1D12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBC1D12.
Información adicional
Size 100 uL
Gene Name TBC1D12
Gene Alias FLJ10339|FLJ12820|KIAA0608
Gene Description TBC1 domain family, member 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MVGPEDAGACSGRNPKLLPVPAPDPVGQDRKVIRATGGFGGGVGAVEPPEEADEEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23232
Iso type IgG

Enviar un mensaje


TBC1D12 polyclonal antibody

TBC1D12 polyclonal antibody