TCHP polyclonal antibody
  • TCHP polyclonal antibody

TCHP polyclonal antibody

Ref: AB-PAB23320
TCHP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TCHP.
Información adicional
Size 100 uL
Gene Name TCHP
Gene Alias MGC10854
Gene Description trichoplein, keratin filament binding
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TCHP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84260
Iso type IgG

Enviar un mensaje


TCHP polyclonal antibody

TCHP polyclonal antibody