LINS1 polyclonal antibody
  • LINS1 polyclonal antibody

LINS1 polyclonal antibody

Ref: AB-PAB23308
LINS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LINS1.
Información adicional
Size 100 uL
Gene Name LINS1
Gene Alias FLJ10583|WINS1
Gene Description lines homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SRVFIEQDDDMLEAAKASLGIYLTLTRGCEATESLTQGKEMWDHHTHENGYNPHCIFLFFLKNIGFDSTVLLDFLISSETCFLEYFVRYLKLLQKDWDN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LINS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55180
Iso type IgG

Enviar un mensaje


LINS1 polyclonal antibody

LINS1 polyclonal antibody