ALG9 polyclonal antibody
  • ALG9 polyclonal antibody

ALG9 polyclonal antibody

Ref: AB-PAB23307
ALG9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALG9.
Información adicional
Size 100 uL
Gene Name ALG9
Gene Alias DIBD1|DKFZp586M2420|FLJ21845|LOH11CR1J
Gene Description asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ALFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ALG9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79796
Iso type IgG

Enviar un mensaje


ALG9 polyclonal antibody

ALG9 polyclonal antibody