CCDC65 polyclonal antibody
  • CCDC65 polyclonal antibody

CCDC65 polyclonal antibody

Ref: AB-PAB23301
CCDC65 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC65.
Información adicional
Size 100 uL
Gene Name CCDC65
Gene Alias FLJ25663|FLJ35732|NYD-SP28
Gene Description coiled-coil domain containing 65
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC65.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85478
Iso type IgG

Enviar un mensaje


CCDC65 polyclonal antibody

CCDC65 polyclonal antibody