RDH16 polyclonal antibody
  • RDH16 polyclonal antibody

RDH16 polyclonal antibody

Ref: AB-PAB23300
RDH16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RDH16.
Información adicional
Size 100 uL
Gene Name RDH16
Gene Alias RODH-4|SDR9C8
Gene Description retinol dehydrogenase 16 (all-trans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RDH16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8608
Iso type IgG

Enviar un mensaje


RDH16 polyclonal antibody

RDH16 polyclonal antibody