OTUD1 polyclonal antibody
  • OTUD1 polyclonal antibody

OTUD1 polyclonal antibody

Ref: AB-PAB23298
OTUD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OTUD1.
Información adicional
Size 100 uL
Gene Name OTUD1
Gene Alias DUBA7|OTDC1
Gene Description OTU domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SSAAEPVIVSRSDPRDEKLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OTUD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 220213
Iso type IgG

Enviar un mensaje


OTUD1 polyclonal antibody

OTUD1 polyclonal antibody