FRMD4A polyclonal antibody
  • FRMD4A polyclonal antibody

FRMD4A polyclonal antibody

Ref: AB-PAB23289
FRMD4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FRMD4A.
Información adicional
Size 100 uL
Gene Name FRMD4A
Gene Alias FLJ10210|FRMD4|KIAA1294|bA295P9.4
Gene Description FERM domain containing 4A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FRMD4A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55691
Iso type IgG

Enviar un mensaje


FRMD4A polyclonal antibody

FRMD4A polyclonal antibody