HISPPD1 polyclonal antibody
  • HISPPD1 polyclonal antibody

HISPPD1 polyclonal antibody

Ref: AB-PAB23287
HISPPD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HISPPD1.
Información adicional
Size 100 uL
Gene Name HISPPD1
Gene Alias FLJ21506|FLJ23463|IP7K2|KIAA0433|PPIP5K2|VIP2
Gene Description histidine acid phosphatase domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSVSSPEGTGTWLHYTSGVGTGRRRRRSGEQITSSPVSPKSLAFTSSIFGSWQQVVSENANYLRTPRTLVEQKQNPTVGSHCA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HISPPD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23262
Iso type IgG

Enviar un mensaje


HISPPD1 polyclonal antibody

HISPPD1 polyclonal antibody