TMEM165 polyclonal antibody
  • TMEM165 polyclonal antibody

TMEM165 polyclonal antibody

Ref: AB-PAB23261
TMEM165 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM165.
Información adicional
Size 100 uL
Gene Name TMEM165
Gene Alias TMPT27|TPARL
Gene Description transmembrane protein 165
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM165.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55858
Iso type IgG

Enviar un mensaje


TMEM165 polyclonal antibody

TMEM165 polyclonal antibody