HOXC11 polyclonal antibody
  • HOXC11 polyclonal antibody

HOXC11 polyclonal antibody

Ref: AB-PAB23260
HOXC11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HOXC11.
Información adicional
Size 100 uL
Gene Name HOXC11
Gene Alias HOX3H|MGC4906
Gene Description homeobox C11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq STVSSFLPQAPSRQISYPYSAQVPPVREVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHATPAGFYSSVNKNSVLP
Form Liquid
Recomended Dilution Immunofluorescence (0.25-2 ug/mL)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HOXC11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3227
Iso type IgG

Enviar un mensaje


HOXC11 polyclonal antibody

HOXC11 polyclonal antibody