SLC17A2 polyclonal antibody
  • SLC17A2 polyclonal antibody

SLC17A2 polyclonal antibody

Ref: AB-PAB23256
SLC17A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC17A2.
Información adicional
Size 100 uL
Gene Name SLC17A2
Gene Alias MGC138238|NPT3
Gene Description solute carrier family 17 (sodium phosphate), member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AIIAMVNTTQQQGLSNASTEGPVADAFNNSSISIKEFDTKASVYQWSPETQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC17A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10246
Iso type IgG

Enviar un mensaje


SLC17A2 polyclonal antibody

SLC17A2 polyclonal antibody