CHCHD5 polyclonal antibody
  • CHCHD5 polyclonal antibody

CHCHD5 polyclonal antibody

Ref: AB-PAB23252
CHCHD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHCHD5.
Información adicional
Size 100 uL
Gene Name CHCHD5
Gene Alias C2orf9|FLJ39671|MGC11104
Gene Description coiled-coil-helix-coiled-coil-helix domain containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPAT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHCHD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84269
Iso type IgG

Enviar un mensaje


CHCHD5 polyclonal antibody

CHCHD5 polyclonal antibody