XPO6 polyclonal antibody
  • XPO6 polyclonal antibody

XPO6 polyclonal antibody

Ref: AB-PAB23249
XPO6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant XPO6.
Información adicional
Size 100 uL
Gene Name XPO6
Gene Alias EXP6|FLJ22519|KIAA0370|RANBP20
Gene Description exportin 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQKLYHKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human XPO6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23214
Iso type IgG

Enviar un mensaje


XPO6 polyclonal antibody

XPO6 polyclonal antibody