CREG2 polyclonal antibody
  • CREG2 polyclonal antibody

CREG2 polyclonal antibody

Ref: AB-PAB23245
CREG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CREG2.
Información adicional
Size 100 uL
Gene Name CREG2
Gene Alias -
Gene Description cellular repressor of E1A-stimulated genes 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CREG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200407
Iso type IgG

Enviar un mensaje


CREG2 polyclonal antibody

CREG2 polyclonal antibody