EPYC polyclonal antibody
  • EPYC polyclonal antibody

EPYC polyclonal antibody

Ref: AB-PAB23243
EPYC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EPYC.
Información adicional
Size 100 uL
Gene Name EPYC
Gene Alias DSPG3|PGLB|Pg-Lb|SLRR3B
Gene Description epiphycan
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EPYC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1833
Iso type IgG

Enviar un mensaje


EPYC polyclonal antibody

EPYC polyclonal antibody