CCDC41 polyclonal antibody
  • CCDC41 polyclonal antibody

CCDC41 polyclonal antibody

Ref: AB-PAB23232
CCDC41 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC41.
Información adicional
Size 100 uL
Gene Name CCDC41
Gene Alias MGC149726|NY-REN-58
Gene Description coiled-coil domain containing 41
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPVSFQSSAMVPSMELPFPPHMQEEQHQRELSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC41.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51134
Iso type IgG

Enviar un mensaje


CCDC41 polyclonal antibody

CCDC41 polyclonal antibody