TBC1D23 polyclonal antibody
  • TBC1D23 polyclonal antibody

TBC1D23 polyclonal antibody

Ref: AB-PAB23230
TBC1D23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBC1D23.
Información adicional
Size 100 uL
Gene Name TBC1D23
Gene Alias DKFZp667G062|FLJ11046|NS4ATP1
Gene Description TBC1 domain family, member 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HLSTAFHLDSDLMLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFMALQQHLADINVDGPENGY
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55773
Iso type IgG

Enviar un mensaje


TBC1D23 polyclonal antibody

TBC1D23 polyclonal antibody