IZUMO1 polyclonal antibody
  • IZUMO1 polyclonal antibody

IZUMO1 polyclonal antibody

Ref: AB-PAB23222
IZUMO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IZUMO1.
Información adicional
Size 100 uL
Gene Name IZUMO1
Gene Alias FLJ61440|IZUMO|MGC34799
Gene Description izumo sperm-egg fusion 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IZUMO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284359
Iso type IgG

Enviar un mensaje


IZUMO1 polyclonal antibody

IZUMO1 polyclonal antibody