C22orf9 polyclonal antibody
  • C22orf9 polyclonal antibody

C22orf9 polyclonal antibody

Ref: AB-PAB23221
C22orf9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C22orf9.
Información adicional
Size 100 uL
Gene Name C22orf9
Gene Alias -
Gene Description chromosome 22 open reading frame 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GCFKDDRIVFWTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDSKKLPGLGDPDIDWEESVCLNLILQKLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C22orf9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23313
Iso type IgG

Enviar un mensaje


C22orf9 polyclonal antibody

C22orf9 polyclonal antibody