WDR44 polyclonal antibody
  • WDR44 polyclonal antibody

WDR44 polyclonal antibody

Ref: AB-PAB23219
WDR44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR44.
Información adicional
Size 100 uL
Gene Name WDR44
Gene Alias DKFZp686L20145|MGC26781|RAB11BP|RPH11
Gene Description WD repeat domain 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB,IHC-P
Immunogen Prot. Seq MRMKYNTEGRVSPSPSQESLSSSKSDTDTGVCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSKNYFLLSSSMDKTVR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54521
Iso type IgG

Enviar un mensaje


WDR44 polyclonal antibody

WDR44 polyclonal antibody