SLC26A8 polyclonal antibody
  • SLC26A8 polyclonal antibody

SLC26A8 polyclonal antibody

Ref: AB-PAB23216
SLC26A8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC26A8.
Información adicional
Size 100 uL
Gene Name SLC26A8
Gene Alias FLJ32714|TAT1
Gene Description solute carrier family 26, member 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELEPEMEPKAETETKTQTEMEPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSVERRRHPMDSYSPEGNSNEDV
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC26A8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116369
Iso type IgG

Enviar un mensaje


SLC26A8 polyclonal antibody

SLC26A8 polyclonal antibody