SH3BP5L polyclonal antibody
  • SH3BP5L polyclonal antibody

SH3BP5L polyclonal antibody

Ref: AB-PAB23213
SH3BP5L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH3BP5L.
Información adicional
Size 100 uL
Gene Name SH3BP5L
Gene Alias FLJ33845|KIAA1720
Gene Description SH3-binding domain protein 5-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq CQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPED
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH3BP5L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80851
Iso type IgG

Enviar un mensaje


SH3BP5L polyclonal antibody

SH3BP5L polyclonal antibody