PDSS1 polyclonal antibody
  • PDSS1 polyclonal antibody

PDSS1 polyclonal antibody

Ref: AB-PAB23207
PDSS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PDSS1.
Información adicional
Size 100 uL
Gene Name PDSS1
Gene Alias COQ1|DPS|MGC70953|RP13-16H11.3|SPS|TPRT|TPT|hDPS1
Gene Description prenyl (decaprenyl) diphosphate synthase, subunit 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PDSS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23590
Iso type IgG

Enviar un mensaje


PDSS1 polyclonal antibody

PDSS1 polyclonal antibody