MEPE polyclonal antibody
  • MEPE polyclonal antibody

MEPE polyclonal antibody

Ref: AB-PAB23201
MEPE polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MEPE.
Información adicional
Size 100 uL
Gene Name MEPE
Gene Alias OF45
Gene Description matrix extracellular phosphoglycoprotein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IPASMNYAKAHSKDKKKPQRDSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGDNDISPFSGDGQPFKDIPGKGEATGPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MEPE.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56955
Iso type IgG

Enviar un mensaje


MEPE polyclonal antibody

MEPE polyclonal antibody