TMEM174 polyclonal antibody
  • TMEM174 polyclonal antibody

TMEM174 polyclonal antibody

Ref: AB-PAB23196
TMEM174 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM174.
Información adicional
Size 100 uL
Gene Name TMEM174
Gene Alias FLJ31268|MGC13034
Gene Description transmembrane protein 174
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LITSGGAAAAMSSPPQYYTIYPQDNSAFVVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYSLPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM174.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 134288
Iso type IgG

Enviar un mensaje


TMEM174 polyclonal antibody

TMEM174 polyclonal antibody