TNKS1BP1 polyclonal antibody
  • TNKS1BP1 polyclonal antibody

TNKS1BP1 polyclonal antibody

Ref: AB-PAB23190
TNKS1BP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TNKS1BP1.
Información adicional
Size 100 uL
Gene Name TNKS1BP1
Gene Alias FLJ45975|KIAA1741|TAB182
Gene Description tankyrase 1 binding protein 1, 182kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDLEVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEARE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TNKS1BP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85456
Iso type IgG

Enviar un mensaje


TNKS1BP1 polyclonal antibody

TNKS1BP1 polyclonal antibody