SH3PXD2A polyclonal antibody
  • SH3PXD2A polyclonal antibody

SH3PXD2A polyclonal antibody

Ref: AB-PAB23188
SH3PXD2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH3PXD2A.
Información adicional
Size 100 uL
Gene Name SH3PXD2A
Gene Alias FISH|SH3MD1
Gene Description SH3 and PX domains 2A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH3PXD2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9644
Iso type IgG

Enviar un mensaje


SH3PXD2A polyclonal antibody

SH3PXD2A polyclonal antibody