ANKRD16 polyclonal antibody
  • ANKRD16 polyclonal antibody

ANKRD16 polyclonal antibody

Ref: AB-PAB23186
ANKRD16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD16.
Información adicional
Size 100 uL
Gene Name ANKRD16
Gene Alias -
Gene Description ankyrin repeat domain 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54522
Iso type IgG

Enviar un mensaje


ANKRD16 polyclonal antibody

ANKRD16 polyclonal antibody