TTC37 polyclonal antibody
  • TTC37 polyclonal antibody

TTC37 polyclonal antibody

Ref: AB-PAB23183
TTC37 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTC37.
Información adicional
Size 100 uL
Gene Name TTC37
Gene Alias KIAA0372|MGC32587
Gene Description tetratricopeptide repeat domain 37
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLGLTYWFMGEETRKDKTKALTHFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVELEDMEMALAILTTVTQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTC37.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9652
Iso type IgG

Enviar un mensaje


TTC37 polyclonal antibody

TTC37 polyclonal antibody