C12orf4 polyclonal antibody
  • C12orf4 polyclonal antibody

C12orf4 polyclonal antibody

Ref: AB-PAB23181
C12orf4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf4.
Información adicional
Size 100 uL
Gene Name C12orf4
Gene Alias FLJ21158|FLJ23899
Gene Description chromosome 12 open reading frame 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KDLKEALTQFIEEESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPSWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGER
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57102
Iso type IgG

Enviar un mensaje


C12orf4 polyclonal antibody

C12orf4 polyclonal antibody