COPG polyclonal antibody
  • COPG polyclonal antibody

COPG polyclonal antibody

Ref: AB-PAB23180
COPG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COPG.
Información adicional
Size 100 uL
Gene Name COPG
Gene Alias COPG1|FLJ21068
Gene Description coatomer protein complex, subunit gamma
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VKQPEKVAATRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COPG.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22820
Iso type IgG

Enviar un mensaje


COPG polyclonal antibody

COPG polyclonal antibody