STOX1 polyclonal antibody
  • STOX1 polyclonal antibody

STOX1 polyclonal antibody

Ref: AB-PAB23175
STOX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STOX1.
Información adicional
Size 100 uL
Gene Name STOX1
Gene Alias C10orf24|PEE4
Gene Description storkhead box 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYKKRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STOX1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219736
Iso type IgG

Enviar un mensaje


STOX1 polyclonal antibody

STOX1 polyclonal antibody