BEND7 polyclonal antibody
  • BEND7 polyclonal antibody

BEND7 polyclonal antibody

Ref: AB-PAB23172
BEND7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BEND7.
Información adicional
Size 100 uL
Gene Name BEND7
Gene Alias C10orf30|FLJ40283|MGC35247
Gene Description BEN domain containing 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BEND7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222389
Iso type IgG

Enviar un mensaje


BEND7 polyclonal antibody

BEND7 polyclonal antibody