C10orf104 polyclonal antibody
  • C10orf104 polyclonal antibody

C10orf104 polyclonal antibody

Ref: AB-PAB23169
C10orf104 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf104.
Información adicional
Size 100 uL
Gene Name C10orf104
Gene Alias FLJ33728|bA570G20.3
Gene Description chromosome 10 open reading frame 104
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf104.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 119504
Iso type IgG

Enviar un mensaje


C10orf104 polyclonal antibody

C10orf104 polyclonal antibody