SNX18 polyclonal antibody
  • SNX18 polyclonal antibody

SNX18 polyclonal antibody

Ref: AB-PAB23168
SNX18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNX18.
Información adicional
Size 100 uL
Gene Name SNX18
Gene Alias FLJ11997|FLJ32560|MGC150827|MGC150829|SH3PX2|SH3PXD3B|SNAG1
Gene Description sorting nexin 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATVSRNLN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNX18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 112574
Iso type IgG

Enviar un mensaje


SNX18 polyclonal antibody

SNX18 polyclonal antibody