C5orf44 polyclonal antibody
  • C5orf44 polyclonal antibody

C5orf44 polyclonal antibody

Ref: AB-PAB23162
C5orf44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C5orf44.
Información adicional
Size 100 uL
Gene Name C5orf44
Gene Alias FLJ13611|FLJ26957|MGC48585
Gene Description chromosome 5 open reading frame 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C5orf44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80006
Iso type IgG

Enviar un mensaje


C5orf44 polyclonal antibody

C5orf44 polyclonal antibody