LOC153364 polyclonal antibody
  • LOC153364 polyclonal antibody

LOC153364 polyclonal antibody

Ref: AB-PAB23158
LOC153364 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC153364.
Información adicional
Size 100 uL
Gene Name LOC153364
Gene Alias DKFZp686P15118|MGC46734
Gene Description similar to metallo-beta-lactamase superfamily protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC153364.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 153364
Iso type IgG

Enviar un mensaje


LOC153364 polyclonal antibody

LOC153364 polyclonal antibody