LSG1 polyclonal antibody
  • LSG1 polyclonal antibody

LSG1 polyclonal antibody

Ref: AB-PAB23151
LSG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LSG1.
Información adicional
Size 100 uL
Gene Name LSG1
Gene Alias FLJ11301
Gene Description large subunit GTPase 1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LSG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55341
Iso type IgG

Enviar un mensaje


LSG1 polyclonal antibody

LSG1 polyclonal antibody