LRCH4 polyclonal antibody
  • LRCH4 polyclonal antibody

LRCH4 polyclonal antibody

Ref: AB-PAB23147
LRCH4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRCH4.
Información adicional
Size 100 uL
Gene Name LRCH4
Gene Alias FLJ40101|FLJ46315|LRN|LRRN1|LRRN4|PP14183|SAP25
Gene Description leucine-rich repeats and calponin homology (CH) domain containing 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDLMTQLRQVLESRLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRCH4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4034
Iso type IgG

Enviar un mensaje


LRCH4 polyclonal antibody

LRCH4 polyclonal antibody