BPIFC polyclonal antibody
  • BPIFC polyclonal antibody

BPIFC polyclonal antibody

Ref: AB-PAB23146
BPIFC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BPIFC.
Información adicional
Size 100 uL
Gene Name BPIFC
Gene Alias RP1-149A16.10-011|BPIL2
Gene Description BPI fold containing family C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NVLSRIAEIYILSQPFMVRIMATEPPIINLQPGNFTLDIPASIMMLTQPKNSTVETIVSMDFVASTSVGLVILGQRLVCSLSLNRFR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BPIFC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254240
Iso type IgG

Enviar un mensaje


BPIFC polyclonal antibody

BPIFC polyclonal antibody