C6orf1 polyclonal antibody
  • C6orf1 polyclonal antibody

C6orf1 polyclonal antibody

Ref: AB-PAB23145
C6orf1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf1.
Información adicional
Size 100 uL
Gene Name C6orf1
Gene Alias LBH|MGC57858
Gene Description chromosome 6 open reading frame 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LRNCMRLSRSCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGPCHLLPLLSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221491
Iso type IgG

Enviar un mensaje


C6orf1 polyclonal antibody

C6orf1 polyclonal antibody