AVPI1 polyclonal antibody
  • AVPI1 polyclonal antibody

AVPI1 polyclonal antibody

Ref: AB-PAB23143
AVPI1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AVPI1.
Información adicional
Size 100 uL
Gene Name AVPI1
Gene Alias PP5395|RP11-548K23.7|VIP32|VIT32
Gene Description arginine vasopressin-induced 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AVPI1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60370
Iso type IgG

Enviar un mensaje


AVPI1 polyclonal antibody

AVPI1 polyclonal antibody