AVPI1 polyclonal antibody Ver mas grande

AVPI1 polyclonal antibody

AB-PAB23143

Producto nuevo

AVPI1 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name AVPI1
Gene Alias PP5395|RP11-548K23.7|VIP32|VIT32
Gene Description arginine vasopressin-induced 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AVPI1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60370
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant AVPI1.

Consulta sobre un producto

AVPI1 polyclonal antibody

AVPI1 polyclonal antibody