C11orf21 polyclonal antibody
  • C11orf21 polyclonal antibody

C11orf21 polyclonal antibody

Ref: AB-PAB23140
C11orf21 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf21.
Información adicional
Size 100 uL
Gene Name C11orf21
Gene Alias -
Gene Description chromosome 11 open reading frame 21
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PHLSSQSGVEPPDRWTGTPGWPSRDQEAPGSMMPPAAAQPSAHGALVPPATAHEPVDHPALHWLACCCCLSLPGQLPLAI
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf21.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29125
Iso type IgG

Enviar un mensaje


C11orf21 polyclonal antibody

C11orf21 polyclonal antibody