CEP164 polyclonal antibody
  • CEP164 polyclonal antibody

CEP164 polyclonal antibody

Ref: AB-PAB23139
CEP164 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP164.
Información adicional
Size 100 uL
Gene Name CEP164
Gene Alias KIAA1052
Gene Description centrosomal protein 164kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP164.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22897
Iso type IgG

Enviar un mensaje


CEP164 polyclonal antibody

CEP164 polyclonal antibody