FAM179A polyclonal antibody
  • FAM179A polyclonal antibody

FAM179A polyclonal antibody

Ref: AB-PAB23133
FAM179A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM179A.
Información adicional
Size 100 uL
Gene Name FAM179A
Gene Alias -
Gene Description family with sequence similarity 179, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLSCNGPRLVGLRSTLQGRGEMVEQLRELTRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM179A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 165186
Iso type IgG

Enviar un mensaje


FAM179A polyclonal antibody

FAM179A polyclonal antibody