C5orf37 polyclonal antibody
  • C5orf37 polyclonal antibody

C5orf37 polyclonal antibody

Ref: AB-PAB23124
C5orf37 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C5orf37.
Información adicional
Size 100 uL
Gene Name C5orf37
Gene Alias FLJ35779|MGC120442|MGC120443|MGC120444
Gene Description chromosome 5 open reading frame 37
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DVVERACQARAEEVCIQISNDYEAKVAMLSGALENAKAEIQRMQHEKEHFEDSMKKAFMRGVCALNLEAMTIFQNRNDAGIDSTNNKKEEYGPGVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C5orf37.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 134359
Iso type IgG

Enviar un mensaje


C5orf37 polyclonal antibody

C5orf37 polyclonal antibody