DNHD2 polyclonal antibody
  • DNHD2 polyclonal antibody

DNHD2 polyclonal antibody

Ref: AB-PAB23122
DNHD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNHD2.
Información adicional
Size 100 uL
Gene Name DNHD2
Gene Alias FLJ40427
Gene Description dynein heavy chain domain 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNHD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201625
Iso type IgG

Enviar un mensaje


DNHD2 polyclonal antibody

DNHD2 polyclonal antibody