DNA2 polyclonal antibody
  • DNA2 polyclonal antibody

DNA2 polyclonal antibody

Ref: AB-PAB23121
DNA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNA2.
Información adicional
Size 100 uL
Gene Name DNA2
Gene Alias DNA2L|FLJ10063|KIAA0083|MGC133297
Gene Description DNA replication helicase 2 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1763
Iso type IgG

Enviar un mensaje


DNA2 polyclonal antibody

DNA2 polyclonal antibody